SCOPe 2.05: Domain d4po5a_: 4po5 A:

Lineage for d4po5a_ (4po5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [260740] (1 PDB entry)

8. Domain d4po5a_: 4po5 A: [260741]
   Other proteins in same PDB: d4po5b_, d4po5d_, d4po5f_
   automated match to d4f0ua_
   complexed with cyc, so4

Details for d4po5a_

PDB Entry: 4po5, 1.75 Å

PDB Description: Crystal structure of allophycocyanin B from Synechocystis PCC 6803

PDB Compounds: (A:) Allophycocyanin subunit alpha-B

SCOPe Domain Sequences for d4po5a_:

Sequence; same for both SEQRES and ATOM records:

>d4po5a_ a.1.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk
hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv
pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshh

Timeline for d4po5a_:

• d4po5a_ first appeared in SCOPe 2.04
  
• d4po5a_ is called d4po5a1 in SCOPe 2.06
  
• d4po5a_ appears in the current release, SCOPe 2.08, called d4po5a1