Lineage for d4pmeb_ (4pme B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526416Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1526417Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1526886Protein automated matches [190376] (1 species)
    not a true protein
  7. 1526887Species Human (Homo sapiens) [TaxId:9606] [187223] (5 PDB entries)
  8. 1526889Domain d4pmeb_: 4pme B: [260738]
    automated match to d2roya_
    complexed with cur, edo, fer, na

Details for d4pmeb_

PDB Entry: 4pme (more details), 1.26 Å

PDB Description: human transthyretin (ttr) complexed with ferulic acid and curcumin.
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d4pmeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmeb_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d4pmeb_:

Click to download the PDB-style file with coordinates for d4pmeb_.
(The format of our PDB-style files is described here.)

Timeline for d4pmeb_: