Lineage for d4pfub1 (4pfu B:20-560)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145352Species Thermotoga maritima [TaxId:243274] [259690] (3 PDB entries)
  8. 2145354Domain d4pfub1: 4pfu B:20-560 [260734]
    Other proteins in same PDB: d4pfub2
    automated match to d1vr5a1
    complexed with mab, mg, so4

Details for d4pfub1

PDB Entry: 4pfu (more details), 2.05 Å

PDB Description: crystal structure of mannobiose bound oligopeptide abc transporter, periplasmic oligopeptide-binding protein (tm1226) from thermotoga maritima at 2.05 a resolution
PDB Compounds: (B:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d4pfub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfub1 c.94.1.1 (B:20-560) automated matches {Thermotoga maritima [TaxId: 243274]}
mvlernetmyyggslwsppsnwnpftpwnavpgttglvyetmffydpltgnfdpwlaekg
ewldsktyrvvlregiywhdnvpltsedvrftfeiakkykgihyssvwewldhietpdnr
tvifvfkdpryhewnellytlpivpkhiweekdettilqssneyplgsgpyvahswdqnk
miferfenwwgtkvmgvkpapkyvvivrvlsnnvalgmlmkgeldfsnfmlpgvpilkkv
ynlntwydeppyhlsstvvglflnarkyplslpefrraiamsinadpivqrvyegavlka
dplgflpnsvwmkyypkevvekhgfkydpeeaksildklgfrdvngdgfretpdgkpikl
tiecpygwtdwmqaiqvivdqlkvvginaepyfpdsskyyenmykgefdiemnangtgis
stpwtyfntifypdalesefsytgnygryqnpeveslleelnrtpldnvekvtelcgklg
eillkdlpfiplwygamafitqdnvwtnwpnehnpyawpcgwanwwqtgalkilfnlkpa
k

SCOPe Domain Coordinates for d4pfub1:

Click to download the PDB-style file with coordinates for d4pfub1.
(The format of our PDB-style files is described here.)

Timeline for d4pfub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pfub2
View in 3D
Domains from other chains:
(mouse over for more information)
d4pfua_