Lineage for d1azzb_ (1azz B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60541Protein Crab collagenase [50527] (1 species)
  7. 60542Species Atlantic sand fiddler crab (Uca pugilator) [TaxId:6772] [50528] (1 PDB entry)
  8. 60544Domain d1azzb_: 1azz B: [26073]
    Other proteins in same PDB: d1azzc_, d1azzd_

Details for d1azzb_

PDB Entry: 1azz (more details), 2.3 Å

PDB Description: fiddler crab collagenase complexed to ecotin

SCOP Domain Sequences for d1azzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azzb_ b.47.1.2 (B:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator)}
ivggveavpnswphqaalfiddmyfcggslispewiltaahcmdgagfvdvvlgahnire
deatqvtiqstdftvhenynsfvisndiavirlpvpvtltaaiatvglpstdvgvgtvvt
ptgwglpsdsalgisdvlrqvdvpimsnadcdavygivtdgnicidstggkgtcngdsgg
plnyngltygitsfgaaagceagypdaftrvtyfldwiqtqtgitp

SCOP Domain Coordinates for d1azzb_:

Click to download the PDB-style file with coordinates for d1azzb_.
(The format of our PDB-style files is described here.)

Timeline for d1azzb_: