Lineage for d4p7sb_ (4p7s B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961565Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [260351] (2 PDB entries)
  8. 2961567Domain d4p7sb_: 4p7s B: [260728]
    automated match to d2wkbe_
    complexed with 2ok

Details for d4p7sb_

PDB Entry: 4p7s (more details), 2.87 Å

PDB Description: crystal structure of pfmif in complex with 4-(3-methoxy-5- methylphenoxy)-2-(4-methoxyphenyl)-6-methylpyridine
PDB Compounds: (B:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d4p7sb_:

Sequence, based on SEQRES records: (download)

>d4p7sb_ d.80.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
pccevitnvnlpddnvqstlsqienaisdvmgkplgyimsnydyqknlrfggsneaycfv
ritsigginrsnnsaladqitkllvsnlnvksrriyvefrdcsaqnfafsgs

Sequence, based on observed residues (ATOM records): (download)

>d4p7sb_ d.80.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
pccevitnvnlpddnvqstlsqienaisdvkplgyimsnydyqknlrfggsneaycfvri
tsinnsaladqitkllvsnlnvksrriyvefrdcnfafgs

SCOPe Domain Coordinates for d4p7sb_:

Click to download the PDB-style file with coordinates for d4p7sb_.
(The format of our PDB-style files is described here.)

Timeline for d4p7sb_: