SCOPe 2.06: Domain d4oxra_: 4oxr A:

Lineage for d4oxra_ (4oxr A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (35 species)
   not a true protein

7. Species Staphylococcus pseudintermedius [TaxId:283734] [260726] (2 PDB entries)

8. Domain d4oxra_: 4oxr A: [260727]
   automated match to d1xvla1
   complexed with mn

Details for d4oxra_

PDB Entry: 4oxr, 2 Å

PDB Description: structure of staphylococcus pseudintermedius metal-binding protein sita in complex with manganese

PDB Compounds: (A:) Manganese ABC transporter, periplasmic-binding protein SitA

SCOPe Domain Sequences for d4oxra_:

Sequence; same for both SEQRES and ATOM records:

>d4oxra_ c.92.2.0 (A:) automated matches {Staphylococcus pseudintermedius [TaxId: 283734]}
klkivttnsilydmtknitgdkaeihsivpvgqdpheyeikpkdvqaltdadviiyngfn
lesgngwfekalkqanksikddsviqasknvkpiylkqgeksehnidphawlslgngiey
vktiksalenadkthakdydkqgteylskleklnkeskdkfndipkekrvmitsegafky
faqqfdvkpgyiweintenqgtpeqmkqavdfvkenhiknllletsvsdksmkslgeetg
akiygtvytdsigkkgsdgdsyykmmesniktihesmq

Timeline for d4oxra_:

• d4oxra_ first appeared in SCOPe 2.04
  
• d4oxra_ appears in SCOPe 2.05
  
• d4oxra_ appears in SCOPe 2.07
  
• d4oxra_ appears in the current release, SCOPe 2.08