![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [260723] (2 PDB entries) |
![]() | Domain d4ousa_: 4ous A: [260724] automated match to d2wnvc_ complexed with ca |
PDB Entry: 4ous (more details), 1.05 Å
SCOPe Domain Sequences for d4ousa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ousa_ b.22.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} lrvafsaartanfapgtldqpiafdllhtnlgdmfdtgsgrftcpatgayvfifhilkla isvplyinlmrneevmvsayandgapdhetasnhavlqlfqgdqvwlrlhrgaiygsswk ystfsgfllyqd
Timeline for d4ousa_: