Lineage for d4ousa_ (4ous A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777698Species Zebrafish (Danio rerio) [TaxId:7955] [260723] (2 PDB entries)
  8. 2777699Domain d4ousa_: 4ous A: [260724]
    automated match to d2wnvc_
    complexed with ca

Details for d4ousa_

PDB Entry: 4ous (more details), 1.05 Å

PDB Description: crystal structure of zebrafish caprin-2 c1q domain
PDB Compounds: (A:) Caprin-2

SCOPe Domain Sequences for d4ousa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ousa_ b.22.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lrvafsaartanfapgtldqpiafdllhtnlgdmfdtgsgrftcpatgayvfifhilkla
isvplyinlmrneevmvsayandgapdhetasnhavlqlfqgdqvwlrlhrgaiygsswk
ystfsgfllyqd

SCOPe Domain Coordinates for d4ousa_:

Click to download the PDB-style file with coordinates for d4ousa_.
(The format of our PDB-style files is described here.)

Timeline for d4ousa_: