Lineage for d1azza_ (1azz A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111798Protein Crab collagenase [50527] (1 species)
  7. 111799Species Atlantic sand fiddler crab (Uca pugilator) [TaxId:6772] [50528] (1 PDB entry)
  8. 111800Domain d1azza_: 1azz A: [26072]
    Other proteins in same PDB: d1azzc_, d1azzd_

Details for d1azza_

PDB Entry: 1azz (more details), 2.3 Å

PDB Description: fiddler crab collagenase complexed to ecotin

SCOP Domain Sequences for d1azza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator)}
ivggveavpnswphqaalfiddmyfcggslispewiltaahcmdgagfvdvvlgahnire
deatqvtiqstdftvhenynsfvisndiavirlpvpvtltaaiatvglpstdvgvgtvvt
ptgwglpsdsalgisdvlrqvdvpimsnadcdavygivtdgnicidstggkgtcngdsgg
plnyngltygitsfgaaagceagypdaftrvtyfldwiqtqtgitp

SCOP Domain Coordinates for d1azza_:

Click to download the PDB-style file with coordinates for d1azza_.
(The format of our PDB-style files is described here.)

Timeline for d1azza_: