![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Crab collagenase [50527] (1 species) |
![]() | Species Atlantic sand fiddler crab (Uca pugilator) [TaxId:6772] [50528] (1 PDB entry) |
![]() | Domain d1azza_: 1azz A: [26072] Other proteins in same PDB: d1azzc_, d1azzd_ |
PDB Entry: 1azz (more details), 2.3 Å
SCOPe Domain Sequences for d1azza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} ivggveavpnswphqaalfiddmyfcggslispewiltaahcmdgagfvdvvlgahnire deatqvtiqstdftvhenynsfvisndiavirlpvpvtltaaiatvglpstdvgvgtvvt ptgwglpsdsalgisdvlrqvdvpimsnadcdavygivtdgnicidstggkgtcngdsgg plnyngltygitsfgaaagceagypdaftrvtyfldwiqtqtgitp
Timeline for d1azza_: