Lineage for d4o33a_ (4o33 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141985Protein automated matches [190709] (4 species)
    not a true protein
  7. 2141989Species Human (Homo sapiens) [TaxId:9606] [188478] (20 PDB entries)
  8. 2142009Domain d4o33a_: 4o33 A: [260716]
    automated match to d2p9qa_
    complexed with 3pg, tzn

Details for d4o33a_

PDB Entry: 4o33 (more details), 2.1 Å

PDB Description: Crystal Structure of human PGK1 3PG and terazosin(TZN) ternary complex
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d4o33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o33a_ c.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
mshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsville
nlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvn
lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
aftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
atvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevv
katsrgcittigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni

SCOPe Domain Coordinates for d4o33a_:

Click to download the PDB-style file with coordinates for d4o33a_.
(The format of our PDB-style files is described here.)

Timeline for d4o33a_: