SCOPe 2.05: Domain d4o08a_: 4o08 A:

Lineage for d4o08a_ (4o08 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries)

8. Domain d4o08a_: 4o08 A: [260715]
   automated match to d3fwha_
   complexed with po6, so4

Details for d4o08a_

PDB Entry: 4o08, 1.95 Å

PDB Description: Crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor

PDB Compounds: (A:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4o08a_:

Sequence; same for both SEQRES and ATOM records:

>d4o08a_ c.69.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
mskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynl
sekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliaf
ngphpytfmrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgylt
addvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdp
tfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

Timeline for d4o08a_:

• d4o08a_ first appeared in SCOPe 2.04
  
• d4o08a_ appears in SCOPe 2.06
  
• d4o08a_ appears in the current release, SCOPe 2.08