Lineage for d4o3fa_ (4o3f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141985Protein automated matches [190709] (4 species)
    not a true protein
  7. 2142014Species Mouse (Mus musculus) [TaxId:10090] [188280] (4 PDB entries)
  8. 2142016Domain d4o3fa_: 4o3f A: [260713]
    automated match to d2p9qa_
    complexed with 3pg, tzn

Details for d4o3fa_

PDB Entry: 4o3f (more details), 2.11 Å

PDB Description: Crystal Structure of mouse PGK1 3PG and terazosin(TZN) ternary complex
PDB Compounds: (A:) Phosphoglycerate kinase 1

SCOPe Domain Sequences for d4o3fa_:

Sequence, based on SEQRES records: (download)

>d4o3fa_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
mshlgrpdgvpmpdkyslepvaaelksllgkdvlflkdcvgpevenacanpaagtville
nlrfhveeegkgkdasgnkvkaepakidafraslsklgdvyvndafgtahrahssmvgvn
lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
aftflkvlnnmeigtslydeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
atvasgipagwmgldcgtesskkyaeavgrakqivwngpvgvfeweafargtkslmdevv
katsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv

Sequence, based on observed residues (ATOM records): (download)

>d4o3fa_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
mshlgrpdgvpmpdkyslepvaaelksllgkdvlflkdcvgpevenacanpaagtville
nlrfhveeegkgkdasgnkvkaepakidafraslsklgdvyvndafgtahrahssmvgvn
lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
aftflkvlnnmeigtslydeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
atvasgipagwmgldcgtesskkyaeavgrakqivwngpvgvfeweafargtkslmdevv
katsrgcitiigggdtatdkvshvstgggaslellegkvlpgvdalsnv

SCOPe Domain Coordinates for d4o3fa_:

Click to download the PDB-style file with coordinates for d4o3fa_.
(The format of our PDB-style files is described here.)

Timeline for d4o3fa_: