Lineage for d4ndca_ (4ndc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490700Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1490701Protein automated matches [190513] (24 species)
    not a true protein
  7. 1490714Species Doryteuthis pealeii [TaxId:1051067] [260698] (3 PDB entries)
  8. 1490716Domain d4ndca_: 4ndc A: [260708]
    automated match to d2ccma_
    complexed with ca; mutant

Details for d4ndca_

PDB Entry: 4ndc (more details), 2 Å

PDB Description: x-ray structure of a mutant (t188d) of calexcitin - a neuronal calcium-signalling protein
PDB Compounds: (A:) calexcitin

SCOPe Domain Sequences for d4ndca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndca_ a.39.1.0 (A:) automated matches {Doryteuthis pealeii [TaxId: 1051067]}
qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearatlkl
iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
lfgdlkl

SCOPe Domain Coordinates for d4ndca_:

Click to download the PDB-style file with coordinates for d4ndca_.
(The format of our PDB-style files is described here.)

Timeline for d4ndca_: