![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Doryteuthis pealeii [TaxId:1051067] [260698] (4 PDB entries) |
![]() | Domain d4ndca_: 4ndc A: [260708] automated match to d2ccma_ complexed with ca; mutant |
PDB Entry: 4ndc (more details), 2 Å
SCOPe Domain Sequences for d4ndca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ndca_ a.39.1.0 (A:) automated matches {Doryteuthis pealeii [TaxId: 1051067]} qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearatlkl iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh lfgdlkl
Timeline for d4ndca_: