SCOPe 2.05: Domain d4n1ca_: 4n1c A:

Lineage for d4n1ca_ (4n1c A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4n1ca_: 4n1c A: [260704]
   Other proteins in same PDB: d4n1cc_
   automated match to d2d7tl_

Details for d4n1ca_

PDB Entry: 4n1c, 1.7 Å

PDB Description: structural evidence for antigen receptor evolution

PDB Compounds: (A:) immunoglobulin variable light chain domain

SCOPe Domain Sequences for d4n1ca_:

Sequence; same for both SEQRES and ATOM records:

>d4n1ca_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdiasdlnwyqqkpgkapklliysdsylqsgvps
rfsgsgsgtdftltisslqpedfatyycqqyymipstfgqgtkveik

Timeline for d4n1ca_:

• d4n1ca_ first appeared in SCOPe 2.04
  
• d4n1ca_ appears in SCOPe 2.06
  
• d4n1ca_ appears in the current release, SCOPe 2.08