SCOPe 2.06: Domain d4nffa_: 4nff A:

Lineage for d4nffa_ (4nff A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)

8. Domain d4nffa_: 4nff A: [260701]
   automated match to d2zchp_
   complexed with 0g6

Details for d4nffa_

PDB Entry: 4nff, 1.9 Å

PDB Description: human kallikrein-related peptidase 2 in complex with ppack

PDB Compounds: (A:) Kallikrein-2

SCOPe Domain Sequences for d4nffa_:

Sequence, based on SEQRES records:

>d4nffa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggwecekhsqpwqvavyshgwahcggvlvhpqwvltaahclkknsqvwlgrhnlfepe
dtgqrvpvshsfphplynmsllkhqslrpdedsshdlmllrlsepakitdvvkvlglptq
epalgttcyasgwgsiepeeflrprslqcvslhllsndmcaraysekvtefmlcaglwtg
gkdtcggdsggplvcngvlqgitswgpepcalpekpavytkvvhyrkwikdtiaanp

Sequence, based on observed residues (ATOM records):

>d4nffa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggwecekhsqpwqvavyshgwahcggvlvhpqwvltaahclkknsqvwlgrhnlfepe
dtgqrvpvshsfphplynmslledsshdlmllrlsepakitdvvkvlglptqepalgttc
yasgwgsiepeeflrprslqcvslhllsndmcaraysekvtefmlcaglwtggkdtcggd
sggplvcngvlqgitswgpepcalpekpavytkvvhyrkwikdtiaanp

Timeline for d4nffa_:

• d4nffa_ first appeared in SCOPe 2.04
  
• d4nffa_ appears in SCOPe 2.05
  
• d4nffa_ appears in SCOPe 2.07
  
• d4nffa_ appears in the current release, SCOPe 2.08