Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (24 species) not a true protein |
Species Doryteuthis pealeii [TaxId:1051067] [260698] (3 PDB entries) |
Domain d4nddb_: 4ndd B: [260699] automated match to d2ccma_ complexed with ca; mutant |
PDB Entry: 4ndd (more details), 2.9 Å
SCOPe Domain Sequences for d4nddb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nddb_ a.39.1.0 (B:) automated matches {Doryteuthis pealeii [TaxId: 1051067]} qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearadlkl iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh lfgdlkl
Timeline for d4nddb_: