Class b: All beta proteins [48724] (178 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries) |
Domain d4nbsa3: 4nbs A:321-415 [260696] Other proteins in same PDB: d4nbsa1, d4nbsa2 automated match to d2qn6a2 protein/RNA complex; complexed with fmt, gcp, mg, na |
PDB Entry: 4nbs (more details), 2.31 Å
SCOPe Domain Sequences for d4nbsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nbsa3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d4nbsa3: