Lineage for d4nbsa1 (4nbs A:2-206)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125734Species Sulfolobus solfataricus [TaxId:2287] [255781] (5 PDB entries)
  8. 2125736Domain d4nbsa1: 4nbs A:2-206 [260694]
    Other proteins in same PDB: d4nbsa2, d4nbsa3
    automated match to d2qn6a3
    protein/RNA complex; complexed with fmt, gcp, mg, na

Details for d4nbsa1

PDB Entry: 4nbs (more details), 2.31 Å

PDB Description: The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4nbsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbsa1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdfgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d4nbsa1:

Click to download the PDB-style file with coordinates for d4nbsa1.
(The format of our PDB-style files is described here.)

Timeline for d4nbsa1: