Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d4n1ee_: 4n1e E: [260690] Other proteins in same PDB: d4n1ei_, d4n1ej_, d4n1ek_, d4n1el_ automated match to d2d7tl_ |
PDB Entry: 4n1e (more details), 2.23 Å
SCOPe Domain Sequences for d4n1ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n1ee_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdiaaalnwyqqkpgkapklliyassylqsgvps rfsgsgsgtdftltisslqpedfatyycqqdgyypatfgqgtkvei
Timeline for d4n1ee_: