SCOP 1.61: Domain d1eq9b_: 1eq9 B:

Lineage for d1eq9b_ (1eq9 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)

7. Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry)

8. Domain d1eq9b_: 1eq9 B: [26069]

Details for d1eq9b_

PDB Entry: 1eq9, 1.7 Å

PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf

SCOP Domain Sequences for d1eq9b_:

Sequence; same for both SEQRES and ATOM records:

>d1eq9b_ b.47.1.2 (B:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta)}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk

Timeline for d1eq9b_:

• d1eq9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1eq9b_ appears in SCOP 1.59
  
• d1eq9b_ appears in SCOP 1.63
  
• d1eq9b_ appears in the current release, SCOPe 2.08