Lineage for d1eq9b_ (1eq9 B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 167951Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 168008Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry)
  8. 168010Domain d1eq9b_: 1eq9 B: [26069]

Details for d1eq9b_

PDB Entry: 1eq9 (more details), 1.7 Å

PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf

SCOP Domain Sequences for d1eq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq9b_ b.47.1.2 (B:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta)}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk

SCOP Domain Coordinates for d1eq9b_:

Click to download the PDB-style file with coordinates for d1eq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1eq9b_: