| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries) |
| Domain d4mtec_: 4mte C: [260689] automated match to d2fe3a_ protein/DNA complex; complexed with zn |
PDB Entry: 4mte (more details), 2.5 Å
SCOPe Domain Sequences for d4mtec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mtec_ a.4.5.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
ttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpptvy
raldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimhtl
aakmgfalrhnvieahglcaacveveac
Timeline for d4mtec_: