Lineage for d2mgqa1 (2mgq A:2-68)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306303Species Nematode (Caenorhabditis elegans) [TaxId:6239] [260682] (1 PDB entry)
  8. 2306304Domain d2mgqa1: 2mgq A:2-68 [260683]
    Other proteins in same PDB: d2mgqa2
    automated match to d2m0ca_

Details for d2mgqa1

PDB Entry: 2mgq (more details)

PDB Description: Structure of CEH37 Homeodomain
PDB Compounds: (A:) Homeobox protein ceh-37

SCOPe Domain Sequences for d2mgqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgqa1 a.4.1.0 (A:2-68) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prknrrerttysrqqleiletlfnetqypdvfarervadqirlqesriqvwfknrrakyr
lqekqkp

SCOPe Domain Coordinates for d2mgqa1:

Click to download the PDB-style file with coordinates for d2mgqa1.
(The format of our PDB-style files is described here.)

Timeline for d2mgqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgqa2