Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [260682] (1 PDB entry) |
Domain d2mgqa1: 2mgq A:2-68 [260683] Other proteins in same PDB: d2mgqa2 automated match to d2m0ca_ |
PDB Entry: 2mgq (more details)
SCOPe Domain Sequences for d2mgqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgqa1 a.4.1.0 (A:2-68) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} prknrrerttysrqqleiletlfnetqypdvfarervadqirlqesriqvwfknrrakyr lqekqkp
Timeline for d2mgqa1: