Lineage for d3l70e2 (3l70 E:70-196)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535671Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1535751Protein automated matches [190874] (7 species)
    not a true protein
  7. 1535754Species Gallus gallus [TaxId:9031] [260680] (1 PDB entry)
  8. 1535755Domain d3l70e2: 3l70 E:70-196 [260681]
    Other proteins in same PDB: d3l70e1
    automated match to d1bcce1
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70e2

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l70e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70e2 b.33.1.1 (E:70-196) automated matches {Gallus gallus [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3l70e2:

Click to download the PDB-style file with coordinates for d3l70e2.
(The format of our PDB-style files is described here.)

Timeline for d3l70e2: