Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein automated matches [190874] (7 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries) |
Domain d3l70e2: 3l70 E:70-196 [260681] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1bcce1 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg ddlvvvg
Timeline for d3l70e2: