SCOP 1.67: Domain d1eq9a_: 1eq9 A:

Lineage for d1eq9a_ (1eq9 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry)

8. Domain d1eq9a_: 1eq9 A: [26068]

Details for d1eq9a_

PDB Entry: 1eq9, 1.7 Å

PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf

SCOP Domain Sequences for d1eq9a_:

Sequence; same for both SEQRES and ATOM records:

>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta)}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk

Timeline for d1eq9a_:

• d1eq9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eq9a_ appears in SCOP 1.65
  
• d1eq9a_ appears in SCOP 1.69
  
• d1eq9a_ appears in the current release, SCOPe 2.08