Lineage for d1eq9a_ (1eq9 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) 
Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry) 
Domain d1eq9a_: 1eq9 A: [26068]
complexed with pms
Details for d1eq9a_
PDB Entry: 1eq9 (more details), 1.7 Å
PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf
PDB Compounds: (A:) ChymotrypsinSCOPe Domain Sequences for d1eq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk
SCOPe Domain Coordinates for d1eq9a_:
Click to download the PDB-style file with coordinates for d1eq9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eq9a_:
- d1eq9a_ first appeared (with stable ids) in SCOP 1.55
- d1eq9a_ appears in SCOPe 2.07
View in 3D
