Lineage for d1eq9a_ (1eq9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2794860Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2794958Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry)
  8. 2794959Domain d1eq9a_: 1eq9 A: [26068]
    complexed with pms

Details for d1eq9a_

PDB Entry: 1eq9 (more details), 1.7 Å

PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf
PDB Compounds: (A:) Chymotrypsin

SCOPe Domain Sequences for d1eq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk

SCOPe Domain Coordinates for d1eq9a_:

Click to download the PDB-style file with coordinates for d1eq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1eq9a_: