Lineage for d1ex3a_ (1ex3 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14910Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 14911Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 14961Domain d1ex3a_: 1ex3 A: [26067]

Details for d1ex3a_

PDB Entry: 1ex3 (more details), 3 Å

PDB Description: crystal structure of bovine chymotrypsinogen a (tetragonal)

SCOP Domain Sequences for d1ex3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex3a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

SCOP Domain Coordinates for d1ex3a_:

Click to download the PDB-style file with coordinates for d1ex3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ex3a_: