Lineage for d1ex3a_ (1ex3 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species) Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries) 
Domain d1ex3a_: 1ex3 A: [26067]
Details for d1ex3a_
PDB Entry: 1ex3 (more details), 3 Å
PDB Description: crystal structure of bovine chymotrypsinogen a (tetragonal)
SCOP Domain Sequences for d1ex3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ex3a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan
SCOP Domain Coordinates for d1ex3a_:
Click to download the PDB-style file with coordinates for d1ex3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ex3a_:
- d1ex3a_ appears in SCOP 1.57
- d1ex3a_ appears in the current release, SCOPe 2.07
View in 3D