Lineage for d4d12a1 (4d12 A:1-136)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1919751Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 1919964Protein automated matches [254656] (3 species)
    not a true protein
  7. 1920030Species Aspergillus flavus [TaxId:5059] [260668] (4 PDB entries)
  8. 1920037Domain d4d12a1: 4d12 A:1-136 [260669]
    automated match to d4n9sa1
    complexed with mpd, urc

Details for d4d12a1

PDB Entry: 4d12 (more details), 1.4 Å

PDB Description: crystal structure of cofactor-free urate oxidase anaerobically complexed with uric acid
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d4d12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d12a1 d.96.1.4 (A:1-136) automated matches {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

SCOPe Domain Coordinates for d4d12a1:

Click to download the PDB-style file with coordinates for d4d12a1.
(The format of our PDB-style files is described here.)

Timeline for d4d12a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d12a2