| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
| Protein automated matches [254656] (4 species) not a true protein |
| Species Aspergillus flavus [TaxId:5059] [260668] (5 PDB entries) |
| Domain d4d12a1: 4d12 A:1-136 [260669] automated match to d4n9sa1 complexed with mpd, urc |
PDB Entry: 4d12 (more details), 1.4 Å
SCOPe Domain Sequences for d4d12a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d12a1 d.96.1.4 (A:1-136) automated matches {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve
Timeline for d4d12a1: