Lineage for d1chg__ (1chg -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14910Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 14911Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 14960Domain d1chg__: 1chg - [26066]

Details for d1chg__

PDB Entry: 1chg (more details), 2.5 Å

PDB Description: chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation

SCOP Domain Sequences for d1chg__:

Sequence, based on SEQRES records: (download)

>d1chg__ b.47.1.2 (-) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1chg__ b.47.1.2 (-) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagesekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
sddfaagttcvttgwgldrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d1chg__:

Click to download the PDB-style file with coordinates for d1chg__.
(The format of our PDB-style files is described here.)

Timeline for d1chg__: