Lineage for d1chga_ (1chg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2055966Domain d1chga_: 1chg A: [26066]

Details for d1chga_

PDB Entry: 1chg (more details), 2.5 Å

PDB Description: chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
PDB Compounds: (A:) chymotrypsinogen a

SCOPe Domain Sequences for d1chga_:

Sequence, based on SEQRES records: (download)

>d1chga_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1chga_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagesekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
sddfaagttcvttgwgldrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1chga_:

Click to download the PDB-style file with coordinates for d1chga_.
(The format of our PDB-style files is described here.)

Timeline for d1chga_: