SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4cbbf_ (4cbb F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (40 species)
    not a true protein
  7. 2141444Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries)
  8. 2141452Domain d4cbbf_: 4cbb F: [260659]
    automated match to d2wmea_
    complexed with dtt, edo, gol, k, pe4

Details for d4cbbf_

PDB Entry: 4cbb (more details), 1.8 Å

PDB Description: apo form of betaine aldehyde dehydrogenase from pseudomonas aeruginosa
PDB Compounds: (F:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d4cbbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbbf_ c.82.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
elgdyasvf

SCOPe Domain Coordinates for d4cbbf_:

Click to download the PDB-style file with coordinates for d4cbbf_.
(The format of our PDB-style files is described here.)

Timeline for d4cbbf_: