Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (51 PDB entries) |
Domain d1mtn.2: 1mtn E:,F:,G: [26065] Other proteins in same PDB: d1mtnd_, d1mtnh_ |
PDB Entry: 1mtn (more details), 2.8 Å
SCOP Domain Sequences for d1mtn.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1mtn.2 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa n
Timeline for d1mtn.2: