| Class b: All beta proteins [48724] (176 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
| Protein Mannose-specific adhesin FimH [49406] (1 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
| Species Escherichia coli [TaxId:562] [49407] (23 PDB entries) |
| Domain d4ca4b_: 4ca4 B: [260648] automated match to d4atta_ complexed with kgm; mutant |
PDB Entry: 4ca4 (more details), 2.84 Å
SCOPe Domain Sequences for d4ca4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ca4b_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4ca4b_: