Lineage for d4wgvb_ (4wgv B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347939Domain d4wgvb_: 4wgv B: [260630]
    automated match to d2p49b_

Details for d4wgvb_

PDB Entry: 4wgv (more details), 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody
PDB Compounds: (B:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d4wgvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgvb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

SCOPe Domain Coordinates for d4wgvb_:

Click to download the PDB-style file with coordinates for d4wgvb_.
(The format of our PDB-style files is described here.)

Timeline for d4wgvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wgvd_