Lineage for d3wwke_ (3wwk E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941540Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [260627] (1 PDB entry)
  8. 1941541Domain d3wwke_: 3wwk E: [260628]
    Other proteins in same PDB: d3wwka_, d3wwkd_
    automated match to d4pp8a_

Details for d3wwke_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (E:) Snaclec rhodocytin subunit beta

SCOPe Domain Sequences for d3wwke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwke_ d.169.1.0 (E:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
fka

SCOPe Domain Coordinates for d3wwke_:

Click to download the PDB-style file with coordinates for d3wwke_.
(The format of our PDB-style files is described here.)

Timeline for d3wwke_: