Lineage for d3woua_ (3wou A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779642Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1779643Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1779644Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 1779712Protein automated matches [190195] (6 species)
    not a true protein
  7. 1779723Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (26 PDB entries)
  8. 1779728Domain d3woua_: 3wou A: [260621]
    automated match to d3aoka_
    complexed with gol, tla

Details for d3woua_

PDB Entry: 3wou (more details), 0.99 Å

PDB Description: Crystal Structure of The Recombinant Thaumatin II at 0.99 A
PDB Compounds: (A:) Thaumatin-2

SCOPe Domain Sequences for d3woua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3woua_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgrgicrtgdcggllqckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3woua_:

Click to download the PDB-style file with coordinates for d3woua_.
(The format of our PDB-style files is described here.)

Timeline for d3woua_: