Lineage for d3woua_ (3wou A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778020Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)
  8. 2778021Domain d3woua_: 3wou A: [260621]
    automated match to d3aoka_
    complexed with gol, tla

Details for d3woua_

PDB Entry: 3wou (more details), 0.99 Å

PDB Description: Crystal Structure of The Recombinant Thaumatin II at 0.99 A
PDB Compounds: (A:) Thaumatin-2

SCOPe Domain Sequences for d3woua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3woua_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgrgicrtgdcggllqckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3woua_:

Click to download the PDB-style file with coordinates for d3woua_.
(The format of our PDB-style files is described here.)

Timeline for d3woua_: