Lineage for d1cbw.2 (1cbw F:,G:,H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14910Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 14911Species Cow (Bos taurus) [TaxId:9913] [50523] (42 PDB entries)
  8. 14956Domain d1cbw.2: 1cbw F:,G:,H: [26062]
    Other proteins in same PDB: d1cbwd_, d1cbwi_

Details for d1cbw.2

PDB Entry: 1cbw (more details), 2.6 Å

PDB Description: bovine chymotrypsin complexed to bpti

SCOP Domain Sequences for d1cbw.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cbw.2 b.47.1.2 (F:,G:,H:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOP Domain Coordinates for d1cbw.2:

Click to download the PDB-style file with coordinates for d1cbw.2.
(The format of our PDB-style files is described here.)

Timeline for d1cbw.2: