Lineage for d4wiua2 (4wiu A:245-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143214Species Mycobacterium tuberculosis [TaxId:419947] [260617] (8 PDB entries)
  8. 2143218Domain d4wiua2: 4wiu A:245-606 [260618]
    Other proteins in same PDB: d4wiua1, d4wiua3
    automated match to d1khba1
    complexed with gol, mn, oxl

Details for d4wiua2

PDB Entry: 4wiu (more details), 2.02 Å

PDB Description: crystal structure of pepck (rv0211) from mycobacterium tuberculosis in complex with oxalate and mn2+
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wiua2:

Sequence, based on SEQRES records: (download)

>d4wiua2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl
gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

Sequence, based on observed residues (ATOM records): (download)

>d4wiua2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtnvrrdpmamlpflgynvgdyfqhwinlgkhadesk
lpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldld
gldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg

SCOPe Domain Coordinates for d4wiua2:

Click to download the PDB-style file with coordinates for d4wiua2.
(The format of our PDB-style files is described here.)

Timeline for d4wiua2: