Lineage for d4wiua1 (4wiu A:1-244)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168058Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2168059Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2168155Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2168156Protein automated matches [226847] (5 species)
    not a true protein
  7. 2168178Species Mycobacterium tuberculosis [TaxId:419947] [260615] (8 PDB entries)
  8. 2168182Domain d4wiua1: 4wiu A:1-244 [260616]
    Other proteins in same PDB: d4wiua2, d4wiua3
    automated match to d1khba2
    complexed with gol, mn, oxl

Details for d4wiua1

PDB Entry: 4wiu (more details), 2.02 Å

PDB Description: crystal structure of pepck (rv0211) from mycobacterium tuberculosis in complex with oxalate and mn2+
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wiua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wiua1 c.109.1.0 (A:1-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfir
lnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcm
rgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkal
hsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasama
hdeg

SCOPe Domain Coordinates for d4wiua1:

Click to download the PDB-style file with coordinates for d4wiua1.
(The format of our PDB-style files is described here.)

Timeline for d4wiua1: