Lineage for d4wiua1 (4wiu A:-1-244)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1629565Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1629566Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1629644Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 1629645Protein automated matches [226847] (4 species)
    not a true protein
  7. 1629665Species Mycobacterium tuberculosis [TaxId:419947] [260615] (2 PDB entries)
  8. 1629666Domain d4wiua1: 4wiu A:-1-244 [260616]
    Other proteins in same PDB: d4wiua2
    automated match to d1khba2
    complexed with gol, mn, oxl

Details for d4wiua1

PDB Entry: 4wiu (more details), 2.02 Å

PDB Description: crystal structure of pepck (rv0211) from mycobacterium tuberculosis in complex with oxalate and mn2+
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wiua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wiua1 c.109.1.0 (A:-1-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
mahdeg

SCOPe Domain Coordinates for d4wiua1:

Click to download the PDB-style file with coordinates for d4wiua1.
(The format of our PDB-style files is described here.)

Timeline for d4wiua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wiua2