![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.0: automated matches [254294] (1 protein) not a true family |
![]() | Protein automated matches [254678] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [260612] (1 PDB entry) |
![]() | Domain d4wf2a3: 4wf2 A:271-320 [260613] Other proteins in same PDB: d4wf2a1, d4wf2a2 automated match to d1biaa2 complexed with btx |
PDB Entry: 4wf2 (more details), 2.31 Å
SCOPe Domain Sequences for d4wf2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wf2a3 b.34.1.0 (A:271-320) automated matches {Escherichia coli [TaxId: 83333]} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislrsae
Timeline for d4wf2a3: