Lineage for d4wf2a2 (4wf2 A:64-270)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967898Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2967963Protein automated matches [260609] (1 species)
    not a true protein
  7. 2967964Species Escherichia coli [TaxId:83333] [260610] (1 PDB entry)
  8. 2967965Domain d4wf2a2: 4wf2 A:64-270 [260611]
    Other proteins in same PDB: d4wf2a1, d4wf2a3
    automated match to d1biaa3
    complexed with btx

Details for d4wf2a2

PDB Entry: 4wf2 (more details), 2.31 Å

PDB Description: structure of e. coli bira g142a bound to biotinol-5'-amp
PDB Compounds: (A:) Bifunctional ligase/repressor BirA

SCOPe Domain Sequences for d4wf2a2:

Sequence, based on SEQRES records: (download)

>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records): (download)

>d4wf2a2 d.104.1.2 (A:64-270) automated matches {Escherichia coli [TaxId: 83333]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqapaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltdaaqivigaginmamgwitlqeaginldrntlaamlirelraalelfeqeg
lapylsrwekldn

SCOPe Domain Coordinates for d4wf2a2:

Click to download the PDB-style file with coordinates for d4wf2a2.
(The format of our PDB-style files is described here.)

Timeline for d4wf2a2: