Lineage for d1cbw.1 (1cbw A:,B:,C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2055951Domain d1cbw.1: 1cbw A:,B:,C: [26061]
    Other proteins in same PDB: d1cbwd_, d1cbwi_
    complexed with so4

Details for d1cbw.1

PDB Entry: 1cbw (more details), 2.6 Å

PDB Description: bovine chymotrypsin complexed to bpti
PDB Compounds: (A:) bovine chymotrypsin, (B:) bovine chymotrypsin, (C:) bovine chymotrypsin

SCOPe Domain Sequences for d1cbw.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cbw.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOPe Domain Coordinates for d1cbw.1:

Click to download the PDB-style file with coordinates for d1cbw.1.
(The format of our PDB-style files is described here.)

Timeline for d1cbw.1: