Lineage for d4v0fa1 (4v0f A:4-170)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384586Family b.18.1.30: CBM11 [141116] (2 proteins)
    Pfam PF03425; Carbohydrate binding domain (family 11)
  6. 2384587Protein Endoglucanase H [141117] (2 species)
  7. 2384590Species Ruminiclostridium thermocellum [TaxId:572545] [260604] (1 PDB entry)
  8. 2384591Domain d4v0fa1: 4v0f A:4-170 [260605]
    Other proteins in same PDB: d4v0fa2, d4v0fa3
    complexed with ca, po4
    complexed with ca, po4

Details for d4v0fa1

PDB Entry: 4v0f (more details), 1.45 Å

PDB Description: Structure of Clostridium thermocellum Family 11 Carbohydrate-binding module accommodating the beta-1,3-1,4-mixed linked glucan tetrasaccharide ligand
PDB Compounds: (A:) carbohydrate binding family 11

SCOPe Domain Sequences for d4v0fa1:

Sequence, based on SEQRES records: (download)

>d4v0fa1 b.18.1.30 (A:4-170) Endoglucanase H {Ruminiclostridium thermocellum [TaxId: 572545]}
avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg
dwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssf
rrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga

Sequence, based on observed residues (ATOM records): (download)

>d4v0fa1 b.18.1.30 (A:4-170) Endoglucanase H {Ruminiclostridium thermocellum [TaxId: 572545]}
avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg
dwskwlkisfdiksvgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssfr
rrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga

SCOPe Domain Coordinates for d4v0fa1:

Click to download the PDB-style file with coordinates for d4v0fa1.
(The format of our PDB-style files is described here.)

Timeline for d4v0fa1: