![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.30: CBM11 [141116] (2 proteins) Pfam PF03425; Carbohydrate binding domain (family 11) |
![]() | Protein Endoglucanase H [141117] (2 species) |
![]() | Species Ruminiclostridium thermocellum [TaxId:572545] [260604] (1 PDB entry) |
![]() | Domain d4v0fa1: 4v0f A:4-170 [260605] Other proteins in same PDB: d4v0fa2, d4v0fa3 complexed with ca, po4 complexed with ca, po4 |
PDB Entry: 4v0f (more details), 1.45 Å
SCOPe Domain Sequences for d4v0fa1:
Sequence, based on SEQRES records: (download)
>d4v0fa1 b.18.1.30 (A:4-170) Endoglucanase H {Ruminiclostridium thermocellum [TaxId: 572545]} avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg dwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssf rrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga
>d4v0fa1 b.18.1.30 (A:4-170) Endoglucanase H {Ruminiclostridium thermocellum [TaxId: 572545]} avgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpdg dwskwlkisfdiksvgsaneirfmiaeksingvgdgehwvysitpdsswktieipfssfr rrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikliga
Timeline for d4v0fa1: