SCOPe 2.07: Domain d1cgje_: 1cgj E:

Lineage for d1cgje_ (1cgj E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d1cgje_: 1cgj E: [26060]
   Other proteins in same PDB: d1cgji_

Details for d1cgje_

PDB Entry: 1cgj, 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)

PDB Compounds: (E:) alpha-chymotrypsinogen

SCOPe Domain Sequences for d1cgje_:

Sequence; same for both SEQRES and ATOM records:

>d1cgje_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Timeline for d1cgje_:

• d1cgje_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgje_ appears in SCOPe 2.06
  
• d1cgje_ appears in the current release, SCOPe 2.08