Lineage for d4urka3 (4urk A:544-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726185Domain d4urka3: 4urk A:544-725 [260599]
    Other proteins in same PDB: d4urka1, d4urka2, d4urka4
    automated match to d1e7ua1
    complexed with a82

Details for d4urka3

PDB Entry: 4urk (more details), 2.9 Å

PDB Description: PI3Kg in complex with AZD6482
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4urka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4urka3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg

SCOPe Domain Coordinates for d4urka3:

Click to download the PDB-style file with coordinates for d4urka3.
(The format of our PDB-style files is described here.)

Timeline for d4urka3: